WordPress site example adanaevdenevenakliyatfirmalari.com
adanaevdenevenakliyatfirmalari.com | Website screenshot, Detected themes and WordPress plugins
Installed WordPress theme:
-
Slider
1 151 sites built with Slider plugin
Tasinmak
1 site built with Tasinmak themeInstalled next WordPress plugin:
Domain name zone
The collection of websites with UK domain names.
Explore this curated list of diverse wordpress websites with COM-specific web addresses.
Free checker of available COM domain names for purchasing
